PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0260s0250.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 144aa    MW: 16076.7 Da    PI: 10.1351
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0260s0250.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC598e-19111143133
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlh 33 
                             ++epgrCrRtDGKkWRCs++vl+ +k+C++H+h
  SapurV1A.0260s0250.2.p 111 EPEPGRCRRTDGKKWRCSKEVLPCQKYCDKHIH 143
                             69*****************************98 PP

2QLQ25.93.1e-104072335
                     QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35
                            FT  Qlq+L  Q l+yKy+  + PvP +L+++i
  SapurV1A.0260s0250.2.p 40 FTILQLQELQLQSLIYKYIQVKSPVPYHLVLPI 72
                            7888****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166615.93974IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.6E-84072IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166720.392111143IPR014977WRC domain
PfamPF088793.0E-15112143IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MEGNRRNGRS RSPPIGLGAE LGLGGSSQRS RTGCKITYGF TILQLQELQL QSLIYKYIQV  60
KSPVPYHLVL PILKSVATSL GALSSGLYQL YPSLMGSKCN PLHLEYKNRT EPEPGRCRRT  120
DGKKWRCSKE VLPCQKYCDK HIH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.26e-79hypothetical protein POPTR_0001s08310g
SwissprotQ6AWX76e-34GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9GKS47e-79B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.12e-78(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-19growth-regulating factor 5